PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.RQH3E
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 428aa    MW: 47922.7 Da    PI: 9.0369
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.RQH3EgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.8e-1660104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT +E++++++a k++G   W++I +++g ++t+ q++s+ qk+
      Aradu.RQH3E  60 RERWTDDEHKKFLEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 104
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.07E-1654107IPR009057Homeodomain-like
PROSITE profilePS5129420.49255109IPR017930Myb domain
TIGRFAMsTIGR015576.9E-1758107IPR006447Myb domain, plants
SMARTSM007171.4E-1259107IPR001005SANT/Myb domain
PfamPF002493.3E-1360103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-860100IPR009057Homeodomain-like
CDDcd001672.11E-962105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MAVQDQSGVA RLQGGLTVGN EVSFVSRAYS VPHVQLNDQF SCGNDYSPKV RKPYTITKQR  60
ERWTDDEHKK FLEALKLYGR AWRRIEEHVG TKTAVQIRSH AQKFFSKVVR DSSGNPTSLV  120
EPIEIPPPRP KRKPMHPYPR KLVEIPKREI SNLEHSVRSN SPKSADVDQE NKSPKSVLSA  180
IVSDTLGSSD SDTLAGSLSP VSSMSGGNTS NSALAEPKSS FEEDRSTPLV GLNANSAQHE  240
HPLVKLELSH NESVSTKDDV AEESSSRTLK LFGTTLLLTD TCTPINEVSK PVPINTMHLM  300
QLQSRNSDAT KDPATVVAPW WILSHNRPFI PLHKQPEEKN RDSDLGEFET KEVQKEPSWS  360
GSNTSSVSDE ENTAKSKEQG MSRIRVRPRT FGKGFVPYKR CMAEREKNHY YSTMTCEKTE  420
EQRIKLSL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2086670.0KF208667.1 Arachis hypogaea putative MYB-related protein 13 (MYB13) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015931660.10.0PREDICTED: protein REVEILLE 1-like
RefseqXP_015947535.10.0PREDICTED: protein REVEILLE 1-like
TrEMBLV5T8I40.0V5T8I4_ARAHY; Putative MYB-related protein 13
STRINGGLYMA14G39130.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.19e-52MYB_related family protein